PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G210200.2.p
Common NameSb07g027740, SORBIDRAFT_07g027740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family SBP
Protein Properties Length: 409aa    MW: 42185.5 Da    PI: 8.7992
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G210200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.56.1e-4195170176
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                           +Cqv+gC++dl+++k y+ rhkvC++hsk p v+v+gleqrfCqqCsrfh+l efD+ k+sCrrrLa+hnerrr++
  Sobic.007G210200.2.p  95 RCQVDGCNVDLTDVKPYYCRHKVCKMHSKEPRVVVNGLEQRFCQQCSRFHQLPEFDQLKKSCRRRLAGHNERRRRP 170
                           6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.4E-3391157IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.68493170IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-3994174IPR004333Transcription factor, SBP-box
PfamPF031101.1E-3196169IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MESGGASGGG GGGGGDDQLH GLKFGKKIYF EDAAAAGSSS GGGGGGSGNA SATTAAPATQ  60
QPSPPQAASP RAASGGGGRR GRAAGGPSPA PAPARCQVDG CNVDLTDVKP YYCRHKVCKM  120
HSKEPRVVVN GLEQRFCQQC SRFHQLPEFD QLKKSCRRRL AGHNERRRRP PPGPLATRYG  180
RLAASFGEPG RFRSFMLDFS YPRVPTAMRD GFPAVRPGER APGSIQWQAS LDPHHHQSAV  240
AGYSAHSYGS QGSSSSRPPV FPGPEIPPGG CLAGVPSDSS CALSLLSTQP WDTTHSSGHS  300
HAASMPATAG FDGNPVAPSL MASSYIAPSP WTDSRGHEGG RNVPQLPPDV PLSEVHSGSS  360
SHHGQFSGEL ELALQGNRPA PGSAPAPRND QGSTGAFDQS GNTMDWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-29961691184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444771.10.0hypothetical protein SORBIDRAFT_07g027740
SwissprotQ7EXZ21e-146SPL14_ORYSJ; Squamosa promoter-binding-like protein 14
TrEMBLC5YIS00.0C5YIS0_SORBI; Putative uncharacterized protein Sb07g027740
STRINGSb07g027740.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.19e-41squamosa promoter binding protein-like 9